PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_29527_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 198aa    MW: 22332.8 Da    PI: 9.1713
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_29527_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.31.1e-15247448
                                         S-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  4 WTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                                         W++eEd  l+++v+++G+g +W + +++ g++R++k+c++rw++yl
  cra_locus_29527_iso_1_len_593_ver_3  2 WSPEEDNTLKNYVQKYGTGgNWIALPHKAGLKRCGKSCRLRWLNYL 47
                                         ********************************************97 PP

2Myb_DNA-binding39.91e-125496246
                                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                      Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                                         g +T+eEd  ++ +    G++ W+ Ia+ ++ gRt++++k++w++
  cra_locus_29527_iso_1_len_593_ver_3 54 GGFTEEEDNVILTLYSNIGSR-WSVIASQLQ-GRTDNDVKNYWNT 96
                                         569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.885147IPR017930Myb domain
SMARTSM007173.2E-7149IPR001005SANT/Myb domain
PfamPF002491.2E-14247IPR001005SANT/Myb domain
SuperFamilySSF466893.67E-26294IPR009057Homeodomain-like
CDDcd001672.43E-9247No hitNo description
Gene3DG3DSA:1.10.10.609.8E-24254IPR009057Homeodomain-like
PROSITE profilePS5129420.96748102IPR017930Myb domain
SMARTSM007175.2E-1152100IPR001005SANT/Myb domain
PfamPF002491.5E-115496IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-2455102IPR009057Homeodomain-like
CDDcd001673.40E-85696No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
XWSPEEDNTL KNYVQKYGTG GNWIALPHKA GLKRCGKSCR LRWLNYLRPD IKHGGFTEEE  60
DNVILTLYSN IGSRWSVIAS QLQGRTDNDV KNYWNTKLKK KLLALAAAAS TNKYSTNFPN  120
NSVDLGPINY TKYYGNSSSI PSISTTFPTY NNVDMMMING YNSSSSSSTA ATDNNQLIVS  180
EMFYNNQENL LPLPRLME
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-25210210108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009799606.12e-66PREDICTED: transcription factor RAX2-like
RefseqXP_016453189.12e-66PREDICTED: transcription factor RAX2-like
SwissprotQ9SJL77e-62RAX2_ARATH; Transcription factor RAX2
TrEMBLU5CZ412e-64U5CZ41_AMBTC; Uncharacterized protein
STRINGGLYMA17G35020.22e-62(Glycine max)
STRINGSi002629m2e-62(Setaria italica)
STRINGSb03g003120.11e-62(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154